Reports, passive DNS (pDNS) records, subdomains, Uniform Resource Locators (URLs) and malware samples associated with magicalkenyatravelspecialist.com.
| Domain | magicalkenyatravelspecialist.com |
| WHOIS server | N/A |
| Registrar | N/A |
| Created | N/A |
| Updated | N/A |
| Expiration | N/A |
| Name servers | N/A |
| Emails | N/A |
| Registrant info | N/A |
| Admin info | N/A |
| Tech info | N/A |
| Billing info | N/A |


Note: if the roller icon stops rolling, this means there is a significant number of results being returned. Patience my friend.