Reports, passive DNS (pDNS) records, subdomains, Uniform Resource Locators (URLs) and malware samples associated with googlecookieplacementprivacysettlement.com.
Domain | googlecookieplacementprivacysettlement.com |
WHOIS server | N/A |
Registrar | N/A |
Created | N/A |
Updated | N/A |
Expiration | N/A |
Name servers | N/A |
Emails | N/A |
Registrant info | N/A |
Admin info | N/A |
Tech info | N/A |
Billing info | N/A |
Note: if the roller icon stops rolling, this means there is a significant number of results being returned. Patience my friend.